DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Tmprss9

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:263 Identity:77/263 - (29%)
Similarity:120/263 - (45%) Gaps:41/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SAEASPQ-----------GRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSS 73
            |..|.||           .||:||.....||.||.||::....|.|...::....:|:||||.:.
Mouse   737 STTAKPQECGARPAMDKPTRIVGGISAVSGEVPWQASLKEGPRHFCGATVVGDRWLLSAAHCFNH 801

  Fly    74 VGITPVDASTLAVRLGTINQY-AGGSIV--NVKSVIIHPSY--GNFLHDIAILELDETLVFSDRI 133
            ..:..|.|     .|||::.. .|||.|  .::.|.:||.|  |....|:|:|||.:.|||:..|
Mouse   802 TKVEQVQA-----HLGTVSLLGVGGSPVKLGLRRVALHPRYNPGILDFDVALLELAQPLVFNKYI 861

  Fly   134 QDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ--QKANYNTLSRSLCEWEAGYG 196
            |.:.||....        :.|.|....::|||.:.:|.|:...  |||:...:.:.:|  .|.|.
Mouse   862 QPVCLPLAIH--------KFPVGRKCMISGWGNMQEGNATKPDILQKASVGIIEQKMC--GALYN 916

  Fly   197 Y---ESVVCLSRAEGE-GICRGDAGAAVIDDDK----VLRGLTSFNFGPCGSKYPDVATRVSYYL 253
            :   :.::|....||. ..|:||:|..:..::.    .|.|:.|:..|...:|.|.|..|::...
Mouse   917 FSLTDRMLCAGFLEGRVDSCQGDSGGPLACEETPGVFYLAGIVSWGIGCAQAKKPGVYARITRLK 981

  Fly   254 TWI 256
            .||
Mouse   982 DWI 984

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 71/242 (29%)
Tryp_SPc 29..259 CDD:238113 72/243 (30%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473
Tryp_SPc 756..984 CDD:214473 71/242 (29%)
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.