DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG7142

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:287 Identity:82/287 - (28%)
Similarity:126/287 - (43%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLGLGLLIFGL----ILSAEASPQ----GRILGGEDVAQGEYPWSASVR-----YNKAHVCSGAI 58
            |:.:.|..:||    |.:.||..|    .:.|...:......|:..|::     ....|.|:|.|
  Fly    50 TMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTI 114

  Fly    59 ISTNHILTAAHCVSSVGITPVDASTLAVRLGTINQYAG-GSIVNVKSV---IIHPSY--GNFLHD 117
            |:.:.|||||||:||.  ..|:.|.:......|:...| .|.:.::.:   :.|..|  |...:|
  Fly   115 INEHWILTAAHCLSSP--QAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYD 177

  Fly   118 IAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTA----SYKQQK 178
            ||::...|.|||...:|...||        :.||: |.|... :.|||.:| .||    .::.|:
  Fly   178 IALIYTKEPLVFDTYVQPATLP--------EQDAQ-PEGYGT-LYGWGNVS-MTAVPNYPHRLQE 231

  Fly   179 ANYNTLSRSLCEW---EAGYG-YESVVCLS-RAEGEGICRGDAGAAVI--------DDDKVLRGL 230
            ||...|...|||.   .:|.. :|:.:|.. ...|..||..|:|..:|        :...::.|:
  Fly   232 ANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGI 296

  Fly   231 TSFNFGPCGSK-YPDVATRVSYYLTWI 256
            .|:...|||.| .|.|..|||.:..||
  Fly   297 VSWGKMPCGQKNAPSVFVRVSAFTEWI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 72/256 (28%)
Tryp_SPc 29..259 CDD:238113 74/257 (29%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 73/253 (29%)
Tryp_SPc 84..323 CDD:214473 71/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.