DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG5255

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:277 Identity:83/277 - (29%)
Similarity:131/277 - (47%) Gaps:56/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFGLIL--SAEAS-----PQ---GRILGGEDVAQGEYPWSASVR--YNKAHVCSGAIISTNHI 64
            |::..|:|  |:.||     ||   .||:|||:.|.|..|:..|::  .:.||.|.||||....|
  Fly     3 LILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWI 67

  Fly    65 LTAAHCVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVII-HPSYG--NFLHDIAILELDET 126
            :|||||...     ..|:...|..||.:.:..||.......|: |.:|.  .:.:|||:|.|:|:
  Fly    68 ITAAHCTRG-----RQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNES 127

  Fly   127 LVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDG-------------TASYKQQK 178
            :||.:..|.:.|         |.:|.:| |:.:.:.|||.||.|             ...::|.:
  Fly   128 IVFDNATQPVEL---------DHEALVP-GSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCR 182

  Fly   179 ANYNTLSRSLCEWEAGYGYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFG-PCGSKY 242
            |.::..:|.    :.|:     ||....:|.|.|.||:|..::.:.|:   :...|:| ||...|
  Fly   183 AAHDNSTRV----DIGH-----VCTFNDKGRGACHGDSGGPLVHNGKL---VALVNWGLPCAKGY 235

  Fly   243 PDVATRVSYYLTWIEAN 259
            ||....:|||..:|..:
  Fly   236 PDAHASISYYHDFIRTH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 74/246 (30%)
Tryp_SPc 29..259 CDD:238113 74/248 (30%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 74/246 (30%)
Tryp_SPc 30..252 CDD:238113 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.