DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG17475

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:251 Identity:78/251 - (31%)
Similarity:114/251 - (45%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QGRILGGEDVAQGEYPWSASVR--YNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRL 88
            |.|::.||||..||..:..|::  |. .|:|.|.||...|:|||||||  .|..|   :.|.|..
  Fly    47 QNRVINGEDVQLGEAKYQISLQGMYG-GHICGGCIIDERHVLTAAHCV--YGYNP---TYLRVIT 105

  Fly    89 GTINQYAGGSIVNVKSVIIHPSYG--NFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDA 151
            ||:......::..|:...||.:|.  ::.:|||::.|::|:.|::..|...||          .|
  Fly   106 GTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELP----------TA 160

  Fly   152 ELPNGTPVYVAGWG--ELSDGTASYKQ------------QKANYNTLSRSLCEWEAGYGYESVVC 202
            .:.|||.:.:.|||  ||...|....|            |:...|..|...|.          :|
  Fly   161 PVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCH----------IC 215

  Fly   203 LSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIEA 258
            .....|:|.|.||:|.. :..:.||.||.::.: ||....||....|.|||.||.:
  Fly   216 TLTTGGQGACHGDSGGP-LTHNGVLYGLVNWGY-PCALGVPDSHANVYYYLEWIRS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 75/245 (31%)
Tryp_SPc 29..259 CDD:238113 76/248 (31%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 75/245 (31%)
Tryp_SPc 50..269 CDD:238113 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.