DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and ea

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:284 Identity:88/284 - (30%)
Similarity:128/284 - (45%) Gaps:54/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKA-----HVCSGAIISTNHILTAAHCVSSVG 75
            |.|||      .||.||......|:||.|.:.|.|:     |.|.|::|||.:::||:|||:...
  Fly   121 GNILS------NRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKA 179

  Fly    76 ITPVDASTLAVRLGTINQYAGGSI----------------VNVKSVIIHPSY----GNFLHDIAI 120
            : |.|.....||||..:.......                |.|:..|.||.|    .|.::|||:
  Fly   180 L-PTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIAL 243

  Fly   121 LELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLS 185
            |.|.:.:.::|.::.|.||...:..:...|     |..:.|||||:....:||..:.||......
  Fly   244 LRLAQQVEYTDFVRPICLPLDVNLRSATFD-----GITMDVAGWGKTEQLSASNLKLKAAVEGFR 303

  Fly   186 RSLCEWEAGYGYESV------VCLSRAEGEGICRGDAGAAVI--DDDKV-----LRGLTSFNFGP 237
            ...|  :..|..:.:      :|....||...||||:|..:|  |.:||     |.|:.||...|
  Fly   304 MDEC--QNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTP 366

  Fly   238 CG-SKYPDVATRVSYYLTWIEANT 260
            || :.:|.|.|.|..|:.||: ||
  Fly   367 CGLAGWPGVYTLVGKYVDWIQ-NT 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 80/266 (30%)
Tryp_SPc 29..259 CDD:238113 81/268 (30%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 80/266 (30%)
Tryp_SPc 128..389 CDD:238113 81/269 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.