DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG3916

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:260 Identity:78/260 - (30%)
Similarity:122/260 - (46%) Gaps:42/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LILSAEASPQGRILGGEDVAQGEYPWSASVRYNK----AHVCSGAIISTNHILTAAHCVSSVGIT 77
            ::.|...||. ||.||:.|.: ..|:..|::..:    .|.|.|:|:|..|:||||||:..:.:.
  Fly    20 VVTSTTESPT-RINGGQRVNE-TVPFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCMEKMKVE 82

  Fly    78 PVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYG---NFLHDIAILELDETLVFSDRIQDIALP 139
            .|     :|.:||:|..|||....:.:..:||.|.   ..::|||::::              .|
  Fly    83 DV-----SVVVGTLNWKAGGLRHRLVTKHVHPQYSMNPRIINDIALVKV--------------TP 128

  Fly   140 PTTDEETEDVDAELPNGT-------PVYVAGWGELSDGTASY----KQQKANYNTLSRSLCEWEA 193
            |...|.: |:...|..|:       ||.:.|||..|..|:|.    :.|..||.|:|...|..:.
  Fly   129 PFRLERS-DISTILIGGSDRIGEKVPVRLTGWGSTSPSTSSATLPDQLQALNYRTISNEDCNQKG 192

  Fly   194 GYGYESVVCLSRAEGEGICRGDAGAAVIDDDKV--LRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256
            .....:.:|....:|:|.|.||:|..:|...|.  |.|:.|:....|....|||.||||.:|.:|
  Fly   193 FRVTRNEICALAVQGQGACVGDSGGPLIRPGKQPHLVGIVSYGSSTCAQGRPDVYTRVSSFLPYI 257

  Fly   257  256
              Fly   258  257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 74/247 (30%)
Tryp_SPc 29..259 CDD:238113 74/248 (30%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 74/247 (30%)
Tryp_SPc 31..260 CDD:238113 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.