DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG17404

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:289 Identity:86/289 - (29%)
Similarity:134/289 - (46%) Gaps:45/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADPRITLGLGLL--IFGLILSAEASPQG----RILGGEDVAQGEY-PWSASVRY----NKAHVC 54
            :.:..:.:|:..|  :||.:.|.:  |.|    ||:||.|:..||: |:..|::|    .:.|.|
  Fly     3 LTEQLLLIGVVALGGVFGRLNSRQ--PSGYTPHRIVGGADIPPGEHVPYQVSLQYRTRGGQMHFC 65

  Fly    55 SGAIISTNHILTAAHCVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFL-HDI 118
            .|:||:.|.|||||||...     ::||.::|..|.......||...|.|..|||.|...: .|:
  Fly    66 GGSIIAPNRILTAAHCCQG-----LNASRMSVVAGIRGLNEKGSRSQVLSYSIHPKYQELVTSDL 125

  Fly   119 AILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWG--------ELSDGTASYK 175
            |:|.:...|..::     :.....:..::..|. :..|.||.:.|||        .|.:......
  Fly   126 AVLSIKPPLKLNN-----STISAIEYRSQGKDF-VGGGVPVTLTGWGLRLPVPFPFLDNVNYPNV 184

  Fly   176 QQKANYNTLSRSLCEWEAGYGYESV----VCLSRAEGEGICRGDAGAAVIDDDK---VLRGLTSF 233
            .|:.:|:|:|.|.|.   ..|.|||    :| :|....|.|.||:|..::.:.|   ...|:.|:
  Fly   185 LQRMSYHTISNSECR---NAGMESVTDTEIC-ARGPFRGACSGDSGGPLVMESKNGLQQVGIVSY 245

  Fly   234 NFGPCGSKY-PDVATRVSYYLTWIEANTQ 261
            ....||... |||.||||.:..||...|:
  Fly   246 GLVVCGLYISPDVYTRVSTFSDWIGNQTK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 76/249 (31%)
Tryp_SPc 29..259 CDD:238113 77/251 (31%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 76/249 (31%)
Tryp_SPc 35..269 CDD:238113 75/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.