DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Sp7

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:278 Identity:75/278 - (26%)
Similarity:119/278 - (42%) Gaps:39/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GLGLLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRY--NKAH---VCSGAIISTNHILTAA 68
            |||.|:.........|...::..|.|.|..|:.|.|.:.|  |:..   .|.|::|:..::||||
  Fly   117 GLGNLLPSPPKCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAA 181

  Fly    69 HCVSSVGITPVDASTL-AVRLG---------TINQYAGGSI--VNVKSVIIHPSYG----NFLHD 117
            |||  :|....:...| .||||         .|:......|  :.::...:||.|.    |.:||
  Fly   182 HCV--IGAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHD 244

  Fly   118 IAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYN 182
            ||:|.||..:|.::.||.:.||..:..      ..:..|..:.|:|||..:....|..:|:.:..
  Fly   245 IALLRLDRPVVLNEYIQPVCLPLVSTR------MAINTGELLVVSGWGRTTTARKSTIKQRLDLP 303

  Fly   183 TLSRSLCEWEAG----YGYESVVCLSRAEGEGICRGDAGAAVI----DDDKVLRGLTSFNFGPCG 239
            ......|..:..    :...|.:|:........|.||:|..::    |......|:.||. ..||
  Fly   304 VNDHDYCARKFATRNIHLISSQLCVGGEFYRDSCDGDSGGPLMRRGFDQAWYQEGVVSFG-NRCG 367

  Fly   240 SK-YPDVATRVSYYLTWI 256
            .: :|.|.|||:.|:.||
  Fly   368 LEGWPGVYTRVADYMDWI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 68/257 (26%)
Tryp_SPc 29..259 CDD:238113 70/258 (27%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 68/257 (26%)
Tryp_SPc 137..388 CDD:238113 70/258 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.