DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk1c6

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_038942515.1 Gene:Klk1c6 / 408242 RGDID:1303220 Length:262 Species:Rattus norvegicus


Alignment Length:284 Identity:79/284 - (27%)
Similarity:119/284 - (41%) Gaps:69/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFGLILS---AEASP--QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCV 71
            |.|..|:||   .:|:|  |.|::||....:...||..:|  ....:|.|.:|..:.::|||||.
  Rat     3 LQILFLVLSMGRIDAAPPGQSRVVGGYKCEKNSQPWQVAV--ISRSLCGGVLIDPSWVITAAHCY 65

  Fly    72 SSVGITPVDASTLAVRLGTIN--------QYAGGSIVNVKSVIIHPSYGNFL------------- 115
            |:.      .|...|.||..|        ||.     .|.....||.|..|.             
  Rat    66 SNA------LSYYHVLLGRNNLSEDEPFAQYR-----FVSQSFPHPDYNPFFMRNHTRQPGDDYS 119

  Fly   116 HDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWG-------ELSDGTAS 173
            :|:.:|.|.:....:|.::.|.||      ||:...    |:....:|||       ||.|..  
  Rat   120 NDLMLLHLSKPADITDGVKVIDLP------TEEPKV----GSTCLASGWGSTKPLDWELPDDL-- 172

  Fly   174 YKQQKANYNTLSRSLCEWEAGYG---YESVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFN 234
               |..|.:.||...| .|| |.   .:.::|....| |:..|:||:|..:|.|. ||:|:||:.
  Rat   173 ---QCVNIHLLSNEKC-IEA-YNEKVTDLMLCAGDLEGGKDTCKGDSGGPLICDG-VLQGITSWG 231

  Fly   235 FGPCGS-KYPDVATRVSYYLTWIE 257
            ..||.. ..|.:.|::..:.:||:
  Rat   232 SDPCAEPNMPAIYTKLIKFTSWIK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 69/260 (27%)
Tryp_SPc 29..259 CDD:238113 70/262 (27%)
Klk1c6XP_038942515.1 Tryp_SPc 25..257 CDD:238113 70/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341284
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.