DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:254 Identity:75/254 - (29%)
Similarity:116/254 - (45%) Gaps:35/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SPQG-RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVR 87
            :|.| ::.||:|..:||:||.||::.|..|.|...:||.:.::|||||.    :...:.....|.
  Rat   181 TPGGHKVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCF----VRSANPKDWKVS 241

  Fly    88 LGTI-----NQYAGGSIVNVKSVIIHPSYGNFLH--DIAILELDETLVFSDRIQDIALPPTTDEE 145
            .|.:     .|.|      |||::||.:|....|  |||::.|...:::.:.|:...||..|.  
  Rat   242 FGFLLSKPQAQRA------VKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQ-- 298

  Fly   146 TEDVDAELPNGTPVYVAGWGEL-SDGTASYKQQKANYNTLSRSLCEWEAGYG---YESVVCLSRA 206
                  :.|..:.|.|.|||.| |||.:....||.....:....|.....||   ...::|....
  Rat   299 ------KFPPNSDVVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFL 357

  Fly   207 EGE-GICRGDAGAAVIDDDK----VLRGLTSFNFGPCGSKYPDVATRVSYYLTWIEANT 260
            ||. ..|:||:|..::.:|.    .|.|:.|:.........|.|.|||::|..||.:.|
  Rat   358 EGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISSKT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 70/243 (29%)
Tryp_SPc 29..259 CDD:238113 72/245 (29%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 70/243 (29%)
Tryp_SPc 187..415 CDD:238113 72/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.