DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk4

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:262 Identity:71/262 - (27%)
Similarity:123/262 - (46%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLLIFGLILSAEASPQGRILGGEDVAQGEYPWSASV-RYNKAHVCSGAIISTNHILTAAHCVSS 73
            ||.||..:..|:.:|...||:.|:|......||.|:: ..:.|..|||.::....:|:||||:. 
  Rat    13 LGYLILEVTGSSASSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCIQ- 76

  Fly    74 VGITPVDASTLAVRLGTI--NQYAGGSIVNVKSVIIHPSYG--NFLHDIAILELDETLVFSDRIQ 134
                  |:.|:.:.|..:  :|..|..::.....|.||:|.  :|.:|:.:::|:|:::.|:.|:
  Rat    77 ------DSYTVGLGLHNLEGSQEPGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESNTIR 135

  Fly   135 DIALPPTTDEETEDVDAELPN-GTPVYVAGWGELSDGTASYKQQKANYNTLSRSLCE--WEAGYG 196
            .|           .|.::.|. |....|:|||.|.:|......|..|.:..|...|.  ::..| 
  Rat   136 RI-----------PVASQCPTPGDTCLVSGWGRLKNGKLPSLLQCVNLSVASEETCRLLYDPVY- 188

  Fly   197 YESVVCLSRA-EGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSK-YPDVATRVSYYLTWIEAN 259
            :.|:.|.... :.:..|.||:|..:: .::.|:||.|...|.||.. .|.|.|.:..:..||...
  Rat   189 HLSMFCAGGGPDRKDTCNGDSGGPIV-CNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWIWTT 252

  Fly   260 TQ 261
            .|
  Rat   253 IQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 62/237 (26%)
Tryp_SPc 29..259 CDD:238113 63/239 (26%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 60/233 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.