DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Tryx5

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_006236430.1 Gene:Tryx5 / 408205 RGDID:1302947 Length:251 Species:Rattus norvegicus


Alignment Length:255 Identity:52/255 - (20%)
Similarity:89/255 - (34%) Gaps:77/255 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRY-----NKAHVCSGAIISTNHILTAAHCVS 72
            :||.|:..|.||....:|.|:..:....|.:.:|.|     :....|.|.:|....:||||||  
  Rat     5 IIFALLSLAVASYPEVVLKGDQDSDEYLPENFNVPYMAYLKSSPEPCVGTLIDPLWVLTAAHC-- 67

  Fly    73 SVGITPVDASTLAVRLGTINQYAGGSIVNVKS-------VIIHPSYGNFL--HDIAILELDETLV 128
                    :....:|||....    :|.|.|.       .::||::...:  :|:.:::|.....
  Rat    68 --------SLPTKIRLGVYRP----NIKNEKEQIHGYSLTVVHPNFDANIRKNDLMLIKLSYPAT 120

  Fly   129 FSDRIQD--IALPPTTDEETEDVDAELPNGTPVYVAGWGELSD--------GTASYKQQKAN-YN 182
            ....:..  ||:.|....||    ..:|..|      |...::        .|..|.:..:: :|
  Rat   121 IDMYVGTIAIAMEPMVFNET----CFIPTWT------WNHYNNYSDPDTLTWTNQYSRSPSDCWN 175

  Fly   183 TLSRS--------LCEWEAGYGYE-----------SVVCLSRAEG------EGICRGDAG 217
            ||.:.        :|   .|:.:.           ..:|..|..|      .||..|..|
  Rat   176 TLHQQRQETRINIMC---IGHSFNVKSSTKEVSAAPAICSGRVHGILSWGKAGITNGSEG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 46/240 (19%)
Tryp_SPc 29..259 CDD:238113 46/239 (19%)
Tryx5XP_006236430.1 Tryp_SPc 37..244 CDD:419748 43/223 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.