DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Prss58

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001009174.1 Gene:Prss58 / 408204 RGDID:1303054 Length:240 Species:Rattus norvegicus


Alignment Length:241 Identity:55/241 - (22%)
Similarity:96/241 - (39%) Gaps:54/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YNKAHV-----------------CSGAIISTNHILTAAHCVSS-----VGIT-PVDASTLAVRLG 89
            ||..|:                 |:|.:|....::|:|||...     :||| |.|.:...|.  
  Rat    17 YNPDHIAGTTPPYLVYLKSDYLPCTGVLIHPLWVVTSAHCNLPDLRVILGITNPADTTEHDVE-- 79

  Fly    90 TINQYAGGSIVNVKSVIIHP--SYGNFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAE 152
             ::.|        :.:..||  |..:..:|:.:::|...:..|...:.:.||..|          
  Rat    80 -VSDY--------EKMFRHPYFSVSSISYDLMLIKLRRGIKHSYYAKAVKLPQHT---------- 125

  Fly   153 LPNGTPVYVAGWG-ELSDGTASYKQ-QKANYNTLSRSLCE--WEAGYGYESVVCLSRAEGEGICR 213
            :|......|:.|. .|.|.|..... |..|.:.:|::.|.  ::|....|:::|:....|..:..
  Rat   126 VPVNAMCSVSTWAYNLCDVTKEPDSLQTVNVSVISKAECHNAYKAFDIRENMICVGIVPGRRLPC 190

  Fly   214 GDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVS--YYLTWIE 257
            .:..||....:.||.|:.|:..| |..: .||....|  :|:.|||
  Rat   191 KEVTAAPAVCNGVLYGILSYADG-CVLR-ADVGIYASIFHYMPWIE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 52/238 (22%)
Tryp_SPc 29..259 CDD:238113 55/241 (23%)
Prss58NP_001009174.1 Tryp_SPc 28..233 CDD:214473 49/227 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.