DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG6865

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:258 Identity:73/258 - (28%)
Similarity:111/258 - (43%) Gaps:41/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGI----TPVDASTLAVRL 88
            :|:||.:..:.|.|:..|:.....|.|.|.|||...||||.||:.: |:    .|.....: |.|
  Fly    34 KIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGHCICN-GLQQFMKPAQIQGV-VGL 96

  Fly    89 GTINQYAGG-------SIVNVKSVIIHPSY--GNFLHDIAILELDETLVFSDRIQDIALPPTTDE 144
            .:|.:|..|       ..|:.|:::.||.|  .:..||||:|||.:.:.||..||    |.....
  Fly    97 HSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQ----PSCVGS 157

  Fly   145 ETEDVDAELPNGTPVYVAGWGELSDGTASYKQ----QKANYNTLSRSLCEWEAGYGYESV----- 200
            |......|...||   |:|||...:..|...:    :||.....:...||    ..|.|:     
  Fly   158 EEGHRSLEQEYGT---VSGWGWTHENQAENDRSDVLRKATVKIWNNEACE----RSYRSLGKSNT 215

  Fly   201 -----VCLSRAEGE-GICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIE 257
                 :|.....|: ..|..|:|..::..:..|.|:.|...|......|.:.||||.|::|::
  Fly   216 IGETQLCAGYENGQIDSCWADSGGPLMSKEHHLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 72/255 (28%)
Tryp_SPc 29..259 CDD:238113 73/257 (28%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 72/254 (28%)
Tryp_SPc 35..280 CDD:238113 73/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.