DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG9294

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:253 Identity:75/253 - (29%)
Similarity:123/253 - (48%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RILGGEDVAQGEYPWSASVR-YNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLGTI 91
            :|:||::....:|||.|.:. ||:.: |||::|:..::|||||||..|   |.:..||.. |...
  Fly   100 KIVGGQETRVHQYPWMAVILIYNRFY-CSGSLINDLYVLTAAHCVEGV---PPELITLRF-LEHN 159

  Fly    92 NQYAGGSIV---NVKSVIIHPSYG--NFLHDIAILELDETL-VFSDRIQDIALPPTTDEETEDVD 150
            ..::...||   .|..|.:|..|.  :|.:|:|:|.|::.| :...|::.|.||    .::...|
  Fly   160 RSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLP----VQSYSFD 220

  Fly   151 AELPNGTPVYVAGWG-ELSDGTASYKQQKANYNTLSRSLCE----WEAGYGYESVVCLSRAE--G 208
            .||.     .||||| :...|..:...::.:...|.:|.|.    :..|...::::|.....  |
  Fly   221 HELG-----IVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGG 280

  Fly   209 EGICRGDAGA---AVIDDDK---VLRGLTSFNFGPCGSKYPDVATRVSYYLTWIEANT 260
            :..|.||:|.   ...|:..   .|.|:.|:..|....:.|.|.|||:.||.|:.:||
  Fly   281 KDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSNT 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 72/247 (29%)
Tryp_SPc 29..259 CDD:238113 73/249 (29%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 72/246 (29%)
Tryp_SPc 101..334 CDD:238113 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.