DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG8299

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:284 Identity:77/284 - (27%)
Similarity:127/284 - (44%) Gaps:55/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITLGLGLLIFG----LILSAEASPQGRILGGEDVAQGEYPWSASVR---YNKAHVCSGAIISTNH 63
            ::|.|||.:..    :||:..||....|:||:.....::|:..|||   |...|:|.|:|.:...
  Fly     1 MSLRLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRV 65

  Fly    64 ILTAAHCVSSVGITPVDASTLAVRLGTINQYAGGSI-------VNVKSVIIHPSYG--NFLHDIA 119
            ::|||||:..     ..||.:.:..|.      .||       |.|..:|.|..|.  .:::||.
  Fly    66 VITAAHCIKG-----RYASYIRIVAGQ------NSIADLEEQGVKVSKLIPHAGYNKKTYVNDIG 119

  Fly   120 ILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELS--DGTASYKQQKANYN 182
            ::...|.|.:|..:|.||:.         ::|. |:|....|:|||:.:  |.......:.....
  Fly   120 LIITREPLEYSALVQPIAVA---------LEAP-PSGAQAVVSGWGKRAEDDEALPAMLRAVELQ 174

  Fly   183 TLSRSLCEWEAGYGY--------ESVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPC 238
            .:.:|.|    |..|        :.::|....| |:..|.||:|..:..|. ||.|:.|:..| |
  Fly   175 IIEKSTC----GAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDG-VLVGVVSWGVG-C 233

  Fly   239 GSK-YPDVATRVSYYLTWIEANTQ 261
            |.: :|.|.|.|:.::.|||...:
  Fly   234 GREGFPGVYTSVNSHIDWIEEQAE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/251 (26%)
Tryp_SPc 29..259 CDD:238113 69/253 (27%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 66/251 (26%)
Tryp_SPc 28..255 CDD:238113 69/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.