DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Tmprss4

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:243 Identity:81/243 - (33%)
Similarity:122/243 - (50%) Gaps:31/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLGTIN 92
            |::||.:.:...:||..|::|||.|||.|:|:..:.|||||||....    :|.|:..||.|:..
  Rat   245 RVVGGVEASADSWPWQVSIQYNKQHVCGGSILDHHWILTAAHCFRKY----LDVSSWKVRAGSNK 305

  Fly    93 QYAGGSIVNVKSVIIHPSYGNFLH----DIAILELDETLVFSDRIQDIALPPTTDEETEDVDAEL 153
            .....|:...|..|..|   |.|.    |||:::|...|.||..::.|.||.:        |.||
  Rat   306 LGNSPSLPVAKIFIAEP---NPLQPKEKDIALVKLKMPLTFSGSVRPICLPFS--------DEEL 359

  Fly   154 PNGTPVYVAGWG--ELSDGTASYKQQKANYNTLSRSLCEWEAGYGYE---SVVCLSRAE-GEGIC 212
            ....||:|.|||  |.:.|..|....:|:...:..:.|..|..|..|   .::|....: |:..|
  Rat   360 IPTMPVWVIGWGFTEENGGKMSDTLLQASVQVIDSARCNAEDAYQGEVTAGMLCAGTPQGGKDTC 424

  Fly   213 RGDAGAAVI---DDDKVLRGLTSFNFGPCGS-KYPDVATRVSYYLTWI 256
            :||:|..::   |..:|: |:.|:.:| ||| ..|.|.|:|:.||.||
  Rat   425 QGDSGGPLMYHYDKWQVV-GIVSWGYG-CGSPSTPGVYTKVTAYLDWI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 79/241 (33%)
Tryp_SPc 29..259 CDD:238113 80/242 (33%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346
Tryp_SPc 245..470 CDD:214473 79/241 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.