DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and iotaTry

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:254 Identity:79/254 - (31%)
Similarity:115/254 - (45%) Gaps:26/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSV 74
            |.||:.|.....||:  |||:||.|......||..|::.:..|.|.|.|.|...|:||.||:...
  Fly    11 LVLLLLGDASDVEAT--GRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHER 73

  Fly    75 GITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSY-GNFLH-DIAILELDETLVFSDRIQDIA 137
            .:|     .:.||:|..|...||::|.|.:..:|..: ..||| |||:|.|...|.|....:.|.
  Fly    74 SVT-----LMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAIN 133

  Fly   138 LPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSLC-EWEAGYGY---- 197
            |..|:..          .||.|.|.|||...:|..|...|||....:.|..| ..:.|||.    
  Fly   134 LASTSPS----------GGTTVTVTGWGHTDNGALSDSLQKAQLQIIDRGECASQKFGYGADFVG 188

  Fly   198 ESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256
            |..:|.:..:.:. |.||:|..::...::: |:.|:.:......||.|...|:....||
  Fly   189 EETICAASTDADA-CTGDSGGPLVASSQLV-GIVSWGYRCADDNYPGVYADVAILRPWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 70/234 (30%)
Tryp_SPc 29..259 CDD:238113 71/235 (30%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 70/234 (30%)
Tryp_SPc 28..247 CDD:238113 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.