DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG8738

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:260 Identity:68/260 - (26%)
Similarity:102/260 - (39%) Gaps:54/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GEDVAQGEYPWSASVRYNKAH-VCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLG------ 89
            ||.|. .|:||..::...:.: ||.|.:|....:||:||.|.:     ....:|.||.|      
  Fly   206 GESVF-AEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFN-----RSEDSLLVRAGDWDLNS 264

  Fly    90 --TINQYAGGSIVNVKSVIIHPSYGN--FLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVD 150
              .::.|...:|..:..   |.::.|  ..:|||::.|:.....:..||.|.|||   .||..::
  Fly   265 QTELHPYQMRAISELHR---HENFNNLTLYNDIALVVLERPFQVAPHIQPICLPP---PETPQME 323

  Fly   151 AELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSR--------SLCE-----WEAGYGYE---S 199
            |||.:.: ....|||      ..|...:...|.|.|        ..|:     ...|..|.   |
  Fly   324 AELRSAS-CLATGWG------LRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPS 381

  Fly   200 VVCLSRAEGEGICRGDAGAAVI------DDDKVLRGLTSFNFGPCGSK-YPDVATRVSYYLTWIE 257
            ..|....:|:..|.||.|:.:.      .|...|.||.|:.. .|..| .|...|.|:|...||:
  Fly   382 FTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGI-ECAEKDVPAAYTNVAYLRNWID 445

  Fly   258  257
              Fly   446  445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/257 (26%)
Tryp_SPc 29..259 CDD:238113 68/260 (26%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 67/259 (26%)
Tryp_SPc 207..444 CDD:214473 65/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.