DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG17571

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:251 Identity:79/251 - (31%)
Similarity:127/251 - (50%) Gaps:37/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQGRILGGEDVAQGEYPWSASVRYNK-AHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRL 88
            |.|||:.||||....||:..||:..| :|.|.|::|.:..:||||||:.|..     ||.|.||:
  Fly    27 PFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYA-----ASELQVRV 86

  Fly    89 GTINQYAGGSIVNVKSVIIHPSYGN--FLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDA 151
            |:.::.:||.:|.|::...|..|.:  .::|:||::|...:..:.:|:.|.|          .|:
  Fly    87 GSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIEL----------ADS 141

  Fly   152 ELPNGTPVYVAGWGEL------SDGTASYKQQKANYNTLSRSLCEWEAGYGY------ESVVCLS 204
            |..:||...|:|||..      |..|.    ||...:.|....|..:. |.|      |::|| :
  Fly   142 EAVSGTNAVVSGWGTTCFLFCSSPDTL----QKVEVDLLHYKDCAADT-YNYGSDSILETMVC-A 200

  Fly   205 RAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIEANT 260
            ..|.:..|:||:|..::.|:|:: |:.|:..|...:.||.|...|:...:||...|
  Fly   201 TGEKKDACQGDSGGPLVADNKLV-GVVSWGSGCAWTGYPGVYADVASLRSWIVDTT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 74/242 (31%)
Tryp_SPc 29..259 CDD:238113 75/244 (31%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 74/242 (31%)
Tryp_SPc 31..254 CDD:238113 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.