DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Prss21

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:263 Identity:69/263 - (26%)
Similarity:112/263 - (42%) Gaps:50/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDAST----LAVRL 88
            ||:|||:...|.:||..|:|....|:|...:::...:||||||..... .|.|.:.    |..|.
  Rat    57 RIVGGEEAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHCFQKDN-DPFDWTVQFGELTSRP 120

  Fly    89 GTINQYAGGSIVNVKSVIIHPSY-GNFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAE 152
            ...|..|..:...::.:.:.|.| ..|.||||:|:|...:.:|:.||.|.|..:|        .:
  Rat   121 SLWNLQAYSNRYQIEDIFLSPKYTEQFPHDIALLKLSSPVTYSNFIQPICLLNST--------YK 177

  Fly   153 LPNGTPVYVAGWGELSDGTA---SYKQQKANYNTLSRSLCE------------WEAGYGYESVVC 202
            ..|.|..:|.|||.:.:..:   ....|:.....::.::|.            |      ..:||
  Rat   178 FANRTDCWVTGWGAIGEDESLPLPNNLQEVQVAIINNTMCNHLFKKPDFRINIW------GDMVC 236

  Fly   203 LSRAE-GEGIC---------RGDAGAAVI-DDDKVLR--GLTSFNFGPCG-SKYPDVATRVSYYL 253
            ....| |:..|         :||:|..:: :.|.|..  |:.|:..| || ...|.|.|.:|::.
  Rat   237 AGSPEGGKDACFAKLTYAAPQGDSGGPLVCNQDTVWYQVGVVSWGIG-CGRPNRPGVYTNISHHY 300

  Fly   254 TWI 256
            .||
  Rat   301 NWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 67/261 (26%)
Tryp_SPc 29..259 CDD:238113 68/262 (26%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 67/261 (26%)
Tryp_SPc 58..304 CDD:238113 68/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24256
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.