DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG18563

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:261 Identity:59/261 - (22%)
Similarity:106/261 - (40%) Gaps:60/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLGTINQYA 95
            ||.....|.|.|..::.|.:.::..|::||...||||||..    :..::...:.||       |
  Fly   136 GGRCNTTGLYSWVVALFYEEVYLTGGSLISPKVILTAAHNT----MNKMNEDRIVVR-------A 189

  Fly    96 GGSIVN------------VKSVIIHPS--YGNFLHDIAILELDETLVFSDRIQDIALPPTTDEET 146
            |..::|            |:.::.|..  :.:.::::|::.:....|.:|||..:.||      :
  Fly   190 GEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIGVLTLP------S 248

  Fly   147 EDVDAELPNGTPVYVAGWGELSDGTASYKQ------QKANYNTLSRSLC-----EWEAGYGYE-- 198
            .....|   |....||||    |..:|:.|      :|.....|.|:.|     ....|..::  
  Fly   249 RQASFE---GRRCTVAGW----DLVSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLH 306

  Fly   199 -SVVCLSRAEGEGICRGDAGAAVI----DDDKVL---RGLTSFNFGPCGSKYPDVATRVSYYLTW 255
             |::|.........|.|..|.|:.    |::..:   .|:.::..| ||...|.:.|.|:.:.:|
  Fly   307 PSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMG-CGLDLPGIYTNVAMFRSW 370

  Fly   256 I 256
            |
  Fly   371 I 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 57/259 (22%)
Tryp_SPc 29..259 CDD:238113 59/261 (23%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 55/250 (22%)
Tryp_SPc 147..371 CDD:214473 53/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.