DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG4793

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:258 Identity:69/258 - (26%)
Similarity:112/258 - (43%) Gaps:48/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ILGGEDVAQ-GEYPWSASVRYNKAH--VCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLG- 89
            |....|:|| ||.||..::..:::.  :..|::|:.:.:||     ||.....|....|.||.| 
  Fly    98 ITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLT-----SSTKTLEVPEKYLIVRAGE 157

  Fly    90 ----TINQYAGGSIVNVKSVIIHP--SYGNFLHDIAILELDETLVFSDRIQDIALPPTTDEETED 148
                :|.:......|.::.::.|.  |..|..::.|:|.|...|.....|..|.|||        
  Fly   158 WDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPP-------- 214

  Fly   149 VDAELPNGTPVY----VAGWGELSDGTASYKQ--QKANYNTLSRSLCE--WEAGYGYE-----SV 200
                 ||...::    |:|||:.:....||..  :|.....:.||:|:  .:..||.:     |:
  Fly   215 -----PNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSL 274

  Fly   201 VCLSRAEGEGICRGDAGAAVI-----DDDKV-LRGLTSFNFGPCGSKYPDVATRVSYYLTWIE 257
            :|.....|:..|:||.||.:.     |.::. |.|:.:|.|| ||...|...|.||...:||:
  Fly   275 ICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFG-CGGPLPAAYTDVSQIRSWID 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 67/255 (26%)
Tryp_SPc 29..259 CDD:238113 69/258 (27%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 67/251 (27%)
Tryp_SPc 105..335 CDD:214473 65/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.