DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:252 Identity:81/252 - (32%)
Similarity:126/252 - (50%) Gaps:29/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLGT 90
            |.||:||.:.:..|:||.|.:..:....|.|::|:.:|||||||||:.  :|..|.:.|...||.
  Fly   397 QERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCVAR--MTSWDVAALTAHLGD 459

  Fly    91 INQYAGGSIVNV----KSVIIHPSYG-NFLH-DIAILELDETLVFSDRIQDIALPPTTDEETEDV 149
            .|......:.:|    |.::.|..:. :.|| |:|||.|.|.:.|:..||.|.||.:..:::...
  Fly   460 YNIGTDFEVQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQPICLPTSPSQQSRSY 524

  Fly   150 DAELPNGTPVYVAGWGEL-SDGTASYKQQKANYNTLSRSLCEWEAGYG-----YESVVCLSRAEG 208
                 :|....|||||.| .:|......||.:....:.:.|..:.|..     .||::|..:|..
  Fly   525 -----SGQVATVAGWGSLRENGPQPSILQKVDIPIWTNAECARKYGRAAPGGIIESMICAGQAAK 584

  Fly   209 EGICRGDAGAAVIDDD-----KVLRGLTSFNFGPCG-SKYPDVATRVSYYLTWIEAN 259
            :. |.||:|..::.:|     :|  |:.|:..| || .:||.|.|||:..|.||..|
  Fly   585 DS-CSGDSGGPMVINDGGRYTQV--GIVSWGIG-CGKGQYPGVYTRVTSLLPWIYKN 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 77/245 (31%)
Tryp_SPc 29..259 CDD:238113 78/247 (32%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 77/245 (31%)
Tryp_SPc 400..637 CDD:238113 78/247 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.