DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG40160

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:274 Identity:69/274 - (25%)
Similarity:113/274 - (41%) Gaps:56/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQG---RILGGED-----VAQ-----GEYPWSASVRY--NKAHVCSGAIISTNHILTAAHCVSSV 74
            |:|   |..||.|     |:|     ||:||:.::.:  |.::.|:|::|....:|||||||.| 
  Fly   148 PRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVES- 211

  Fly    75 GITPVDASTLAVRLG-----TINQYAGGSIVNVKSVIIHPSYG--NFLHDIAILELDETLVFSDR 132
                :...:..||.|     |:.:.......:|::||:||.|.  :..:|.|::.|.:.:...|.
  Fly   212 ----LRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDH 272

  Fly   133 IQDIALPPTTDEETEDVDAELPN-GTPVYVAGWGELSDGT-ASYKQQK-------ANYNTLSRSL 188
            |..|.||...|         :|. |...:..|||:.:.|: ..|....       ..:|:....|
  Fly   273 INVICLPQQDD---------IPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRL 328

  Fly   189 CEWEAGYGY---ESVVCLSRAEGEGICRGDAGAAVIDDDKVLR-------GLTSFNFGPCGSKYP 243
            .....|..:   .|.:|.....|...|:||.||.:.......|       |:.::..| |..:.|
  Fly   329 RGTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIG-CNDEVP 392

  Fly   244 DVATRVSYYLTWIE 257
            .....|:....||:
  Fly   393 AAYANVALVRGWID 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 65/265 (25%)
Tryp_SPc 29..259 CDD:238113 66/267 (25%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 63/256 (25%)
Tryp_SPc 169..405 CDD:214473 59/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.