DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG18557

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:287 Identity:73/287 - (25%)
Similarity:122/287 - (42%) Gaps:70/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIFGLILS-AEASPQGRILGG--EDVAQ----GEYPWSASVRYNKAHVC-SGAIISTNHILTAAH 69
            |:.|..|: .:::|.|  |||  |:|..    .|:||:.::..|..:.. :|.:::.|.::||||
  Fly    63 LVIGAPLNCGKSNPNG--LGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAH 125

  Fly    70 -----CVSSVGITPVDASTLAVRLG---TINQYAGGSIV--NVKSVIIHPSYGNF--LHDIAILE 122
                 .::..||           :|   .:.|.||.:|.  ....::.||.:...  .::||::.
  Fly   126 LMLDKTINDFGI-----------IGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIV 179

  Fly   123 LDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTA---SYKQQKANYNTL 184
            |:.:.|....|..|..|      |..|..:...   ..|||||. .|..|   ||||:|.:...:
  Fly   180 LETSFVMKPPIGPICWP------TSGVSFDRER---CLVAGWGR-PDFLAKNYSYKQKKIDLPIV 234

  Fly   185 SRSLCE-------WEAGYGYE-SVVCLSRAEGEGICRGDAGA----------AVIDDDKVLRGLT 231
            |||.||       :...:..: :::|.....|...|.||.|:          |:.:    |.|:.
  Fly   235 SRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYE----LVGIV 295

  Fly   232 SFNFGPCG-SKYPDVATRVSYYLTWIE 257
            :..|. || ...|.:.|.:|:...|||
  Fly   296 NSGFS-CGLENVPALYTNISHMRPWIE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 65/268 (24%)
Tryp_SPc 29..259 CDD:238113 68/270 (25%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 63/260 (24%)
Tryp_SPc 90..320 CDD:214473 60/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.