DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG1304

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:265 Identity:98/265 - (36%)
Similarity:147/265 - (55%) Gaps:25/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITLGLGLLIFGL-ILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAH 69
            |.||..||:..: :.||..|..||::||||..:.::|...|:|...:|.|.|:|:|.|::|||||
  Fly     8 ILLGSFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAH 72

  Fly    70 CV----SSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFLHDIAILELDETLVFS 130
            ||    |:....|:.|....:|.|:.::::||.:|.|..||:|..|||||:|:|:|.|:..|:.|
  Fly    73 CVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILS 137

  Fly   131 DRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGEL--SDGTASYKQQKANYNTL---SRSLCE 190
            ..||.|.||  |.:...|||        |.::|||.:  ......|.|    ||||   |...|:
  Fly   138 ASIQPIDLP--TADTPADVD--------VIISGWGRIKHQGDLPRYLQ----YNTLKSISLERCD 188

  Fly   191 WEAGYGYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTW 255
            ...|:|.:|.:||......|.|.||:|...:.:::|: |:..|.:..||:.|||...||.|:..|
  Fly   189 ELIGWGVQSELCLIHEADNGACNGDSGGPAVYNNQVV-GVAGFVWSACGTSYPDGYARVYYHNEW 252

  Fly   256 IEANT 260
            |:.|:
  Fly   253 IKNNS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 86/236 (36%)
Tryp_SPc 29..259 CDD:238113 87/238 (37%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 86/236 (36%)
Tryp_SPc 32..256 CDD:238113 87/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 1 1.000 - - otm47449
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.