DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG9672

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:269 Identity:81/269 - (30%)
Similarity:126/269 - (46%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITLGLGLLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHC 70
            :|:||.|:..|::   ||.|||||.||||...|:.|:.|::....::.|...||...:.|||..|
  Fly     5 LTIGLILVAAGVL---EAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSC 66

  Fly    71 VSSVG-ITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFLHDIAILELDETLVFSDRIQ 134
            |.|.| .||..|...||.:|:::.| .|..:.|:.:.|:|:|......||:|.|.|.:.||:.:.
  Fly    67 VCSDGKDTPWAAVLFAVTVGSVDLY-NGKQIRVEEITINPNYSTLKTGIALLRLQEEITFSETVN 130

  Fly   135 DIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSLCEW-------- 191
            .|.|       ::||.   |.|:.|.|:|||..::...:.      :.||.....|.        
  Fly   131 AIPL-------SQDVP---PMGSQVEVSGWGRTTESEVNM------HRTLQIGAAEVMAPRECAL 179

  Fly   192 ----EAGYGYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYY 252
                |.....:.|:||.....:|||.||.|...:...::: ||.:...|.||...|:....::..
  Fly   180 ANRDELLVADDQVLCLGHGRRQGICSGDIGGPAVYQGQLV-GLGAQILGECGGMLPERFISIAAN 243

  Fly   253 LTWIEANTQ 261
            ..||:...|
  Fly   244 YDWIQQQLQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 68/240 (28%)
Tryp_SPc 29..259 CDD:238113 69/242 (29%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 68/240 (28%)
Tryp_SPc 25..250 CDD:238113 69/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25869
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.