DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and sphe

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:258 Identity:110/258 - (42%)
Similarity:146/258 - (56%) Gaps:14/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADPRITLGLGLLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHIL 65
            |..||:.: |||:  ||........||||:||||.......::||:|.:.||||.|:|:|...||
  Fly     1 MMQPRLVI-LGLI--GLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKIL 62

  Fly    66 TAAHCVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFLHDIAILELDETLVFS 130
            |.||||...| ..:|||.||.|:|:.||||||.||||:||.:||.|.|..:::|::.|...|.::
  Fly    63 TTAHCVHRDG-KLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLNNNLAVITLSSELTYT 126

  Fly   131 DRIQDIALPPTTDEETEDVDAELP-NGTPVYVAGWGELSDGTASYKQQKANYNTLSRSLCEWEAG 194
            |||  .|:|.....|.      || .|:.|.|||||..||||.|||.::.:......:.|.....
  Fly   127 DRI--TAIPLVASGEA------LPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYS 183

  Fly   195 YGYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIE 257
            ...|...||:....||.|.||.|...|..:.:: |||:|..|.|||:||||..|:|.|..||:
  Fly   184 DHDEQSFCLAHELKEGTCHGDGGGGAIYGNTLI-GLTNFVVGACGSRYPDVFVRLSSYADWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 98/228 (43%)
Tryp_SPc 29..259 CDD:238113 99/230 (43%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 93/214 (43%)
Tryp_SPc 42..244 CDD:214473 91/211 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 1 1.000 - - otm47449
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.