DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG33160

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:261 Identity:67/261 - (25%)
Similarity:114/261 - (43%) Gaps:40/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IFGLILSAEASP-----QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSS 73
            |.|...:..|.|     |.||:||...:..|..:...|..:: .:|.|:::....::||||||.:
  Fly    14 ILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSE-ELCGGSLVKPRWVITAAHCVYN 77

  Fly    74 VGITPVDASTLAVRLGTINQYAGGSIV-NVKSVIIHPSYG--NFLHDIAILELDETLVFSDRIQD 135
                 .:.:...:..|..||....::: .|..:.|.|.:.  ....|:|.|.|:..::.:: |:.
  Fly    78 -----KNKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGAN-IET 136

  Fly   136 IALPPTTDEETEDVDAELPNGTPVYVAGWGEL-SDGTASYKQQKANYNTL----SRSLCEWEAGY 195
            |.|...:          :|....|.|:|||.| :|.|   |..:..::.|    ||:.|. .|..
  Fly   137 IPLAAQS----------VPARALVKVSGWGFLTADAT---KTAERVHSVLVPMWSRASCV-SAFR 187

  Fly   196 GY----ESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256
            |.    .|:||.:|...:..|.||:|..::...: |.|:.||.:| |.|..|.:.|.|.....|.
  Fly   188 GIHRITRSMVCAARLYKKDSCDGDSGGPLVYRGQ-LAGIVSFGYG-CASALPGIYTSVPEIRDWF 250

  Fly   257 E 257
            :
  Fly   251 Q 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 61/239 (26%)
Tryp_SPc 29..259 CDD:238113 61/241 (25%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 61/238 (26%)
Tryp_SPc 34..253 CDD:238113 61/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.