DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG33159

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:266 Identity:74/266 - (27%)
Similarity:128/266 - (48%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGLGLLIF----GLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAA 68
            :||.||.:    .|:|.:.:| :.||:||::....|.|:...:|.|...:|.|::||:..:|:||
  Fly     2 VGLRLLWWLCHLALVLPSSSS-KTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAA 65

  Fly    69 HCVSSVGITPVDASTLAVRLGTINQYAGGSIVN-----VKSVII---HPSYG--NFLHDIAILEL 123
            |||  .|..| :..|:         :||.|.::     |::|::   .|||.  ||..|:|:|:|
  Fly    66 HCV--YGSQP-EGFTV---------HAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQL 118

  Fly   124 DETLVFS-DRIQDIALPPTTDEETEDVDAELPNGTP-VYVAGWGELSDGTASYKQQKANYNTLSR 186
            .|.:|.: .::..|:  |..:.         |.|.. ..::|||...:......:|..  .|:.|
  Fly   119 QEVVVLTPGKVATIS--PCRNP---------PEGNAYARISGWGVTRENNREPAEQVR--TTMVR 170

  Fly   187 SL----CEWE-AGYGY--ESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPD 244
            .|    |:.. :|||.  :|::|.:.......|.||:|..::...:|. |:.|:.||.....:|.
  Fly   171 VLPGAECKISYSGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVC-GIVSWGFGCARPSFPG 234

  Fly   245 VATRVS 250
            |.|.|:
  Fly   235 VYTNVA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 67/242 (28%)
Tryp_SPc 29..259 CDD:238113 66/241 (27%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 67/242 (28%)
Tryp_SPc 26..251 CDD:238113 66/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.