DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG31681

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:277 Identity:82/277 - (29%)
Similarity:128/277 - (46%) Gaps:54/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RITLGLGLLIFGLILSAE-ASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAA 68
            |:.|.:.:.|.||..:|. ..|:.||:||..:.....||..||:.|..|.|.|.|.|...|||||
  Fly     4 RLLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAA 68

  Fly    69 HCVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFL---HDIAILELDETLVFS 130
            ||:|:|.:|     .|:||.|:.....||.::.|...|.||.|...|   :|||:|.|:..|...
  Fly    69 HCLSNVTVT-----DLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLG 128

  Fly   131 DRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANY----------NTLS 185
            ..::.|.|...|...          ||.|..:|||        |.::.:::          ..|:
  Fly   129 GTVKKIPLAEQTPVA----------GTIVLTSGWG--------YTRENSSFLWPILQGVHVAILN 175

  Fly   186 RSLCEWEAGYGYESV----VCLSRAEGE--GICRGDAGAAVIDDDK----VLRGLTSFNFGPCGS 240
            |:.|  ...|.:.::    :|   |:|:  ..|:||:|..:|:..|    .|.|:.|:..| ||:
  Fly   176 RTDC--LKAYKHVNITIDMIC---ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDG-CGT 234

  Fly   241 KYPDVATRVSYYLTWIE 257
            . |.|...::::..||:
  Fly   235 N-PGVYEDIAFFHNWIK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 73/250 (29%)
Tryp_SPc 29..259 CDD:238113 74/252 (29%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 73/250 (29%)
Tryp_SPc 29..250 CDD:238113 73/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.