DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG31269

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:272 Identity:86/272 - (31%)
Similarity:124/272 - (45%) Gaps:45/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITLGL-GLLIFGLILSAEASPQG------RILGGEDVAQGEYPWSASVR-YNKAHVCSGAIISTN 62
            |.||| ||:....|.....|..|      ||:||:....|..|:..|:: .:.||.|.||||:..
  Fly     8 ILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINET 72

  Fly    63 HILTAAHCVSSVGITPVDASTLAVRLGTINQY--AGGSIVNVKSVIIHPSYGN--FLHDIAILEL 123
            .:|||||||.:..|     ..|.|..|| |:|  .||... :|::.||.:|.|  ..:|||:|||
  Fly    73 FVLTAAHCVENAFI-----PWLVVVTGT-NKYNQPGGRYF-LKAIHIHCNYDNPEMHNDIALLEL 130

  Fly   124 DETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGE-LSDGTASYKQQKANYNTLSRS 187
            .|.:.:.:|.|.|.||.          ..:..|..|.:.|||. :..||:....|......:...
  Fly   131 VEPIAWDERTQPIPLPL----------VPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHR 185

  Fly   188 LC--------EWEAGYGYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPD 244
            .|        :.:.|:     :|.....|||.|.||:|..::.:. .|.||.::.: ||.:..||
  Fly   186 ECKALLSNDEDCDVGH-----ICTFSRLGEGACHGDSGGPLVSNG-YLVGLVNWGW-PCATGVPD 243

  Fly   245 VATRVSYYLTWI 256
            |...|.:|..||
  Fly   244 VHASVYFYRDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 75/241 (31%)
Tryp_SPc 29..259 CDD:238113 76/242 (31%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/241 (31%)
Tryp_SPc 38..258 CDD:238113 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.