DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG32755

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:269 Identity:82/269 - (30%)
Similarity:124/269 - (46%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SAEASP---QGRILGGEDVAQGEYPWSASVR--------YNKAHVCSGAIISTNHILTAAHCV-- 71
            :|.|||   ..:|:||..|...:.|:..|||        |...|||.||:||...:.:||||.  
  Fly    26 TATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAI 90

  Fly    72 -SSVGITPVDASTLAVRLGTINQYAGGSIVN----------VKSVIIHPSY-GNFL-HDIAILEL 123
             :||.:...|.....|       .||.|.::          |:.::.|..| |:.| :|||:|.|
  Fly    91 NTSVPLVYRDPELYVV-------VAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFL 148

  Fly   124 DETLVF-SDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRS 187
            :..:.: |..::.|.|.....||          ||...:.|||:::....|...|:|....|::.
  Fly   149 NGFIPWESPGVRAIPLAIKAPEE----------GTTCLIHGWGKVTMKEKSASLQQAPVPILNKE 203

  Fly   188 LCEWEAGYGYE---SVVCLSRAEGEGI--CRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVAT 247
            ||:    ..|:   |.:|....:| ||  |:||:|..:|.|.: |.|:.|:..|.....||.|.|
  Fly   204 LCQ----VIYKLPASQMCAGFLQG-GIDACQGDSGGPLICDGR-LAGIISWGVGCADPGYPGVYT 262

  Fly   248 RVSYYLTWI 256
            .||::|.||
  Fly   263 NVSHFLKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 76/256 (30%)
Tryp_SPc 29..259 CDD:238113 78/257 (30%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 76/256 (30%)
Tryp_SPc 38..273 CDD:238113 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.