DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk15

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:278 Identity:81/278 - (29%)
Similarity:122/278 - (43%) Gaps:57/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFGLILSAEASPQGRILGGEDVAQGEYPWSASV----RYNKAHVCSGAIISTNHILTAAHCVS 72
            ||.|.|::|| |....::|.||:......||..::    |:|    |...:||...:||||||  
Mouse     4 LLAFVLLVSA-AQDGDKVLEGEECVPHSQPWQVALFERGRFN----CGAFLISPRWVLTAAHC-- 61

  Fly    73 SVGITPVDASTLAVRLG--TINQYAG-GSIVNVKSVIIHPSY--GNFLHDIAILELDETLVFSDR 132
                   ....:.||||  .:.::.| ..:.:|..:|.||.|  ....|||.:|.|.:....:..
Mouse    62 -------QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPARLTAY 119

  Fly   133 IQDIALP---PTTDEETEDVDAELPNGTPVYVAGWGELSD----GTASYKQQK--------ANYN 182
            ::.:|||   |...|:             ..|:|||.|||    .|.|.|...        ||.:
Mouse   120 VRPVALPRRCPLIGED-------------CVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANIS 171

  Fly   183 TLSRSLCEWE-AGYGYESVVCLSRAEGEGI--CRGDAGAAVIDDDKVLRGLTSFNFGPCG-SKYP 243
            .:|.:.|..: .|....::|| :..||.|.  |.||:|..::... .|:|:.|:...||. :..|
Mouse   172 IISEASCNKDYPGRVLPTMVC-AGVEGGGTDSCEGDSGGPLVCGG-ALQGIVSWGDVPCDTTTKP 234

  Fly   244 DVATRVSYYLTWIEANTQ 261
            .|.|:|..||.||..|.:
Mouse   235 GVYTKVCSYLEWIWENVR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 71/255 (28%)
Tryp_SPc 29..259 CDD:238113 73/257 (28%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 70/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.