DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG6048

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:262 Identity:69/262 - (26%)
Similarity:104/262 - (39%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ASPQGRILGGEDVAQGEYPWSASVR--------YNKAHVCSGAIISTNHILTAAHCVSSVGI--- 76
            |.| |||:.|.:.:.|.......:|        :...|:|.|::|....:||||||.....|   
  Fly    41 ADP-GRIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDG 104

  Fly    77 TPVDASTLAVRLGTINQYAGGSIVNVKSVIIHP--------SYGNFLHDIAILELDETL-VFSDR 132
            |.|......|.:|.:::|   :..|..:..|..        ....:..|||:|.|:.|: .....
  Fly   105 TFVPKEEFIVVMGNLDRY---NRTNTLTFTIEERIMQLDKFDLSTYDKDIALLMLNGTVPTGHPT 166

  Fly   133 IQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSLCEWEAGYGY 197
            |:.|||....          :|.|....|.|||...||..|......:...:|...|..::..|:
  Fly   167 IRPIALNRFA----------IPEGVVCQVTGWGNTEDGYVSDILMTVDVPMISEEHCINDSDLGH 221

  Fly   198 ---ESVVCLSRAE-GE-GICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIE 257
               ..::|....| || ..|.||:|..::...: |.|:.|:.......:.|.|.|.||||..||.
  Fly   222 LIQPGMICAGYLEVGEKDACAGDSGGPLVCQSE-LAGVVSWGIQCALPRLPGVYTEVSYYYDWIL 285

  Fly   258 AN 259
            .|
  Fly   286 QN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 63/252 (25%)
Tryp_SPc 29..259 CDD:238113 64/254 (25%)
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 63/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.