DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Prtn3

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:241 Identity:64/241 - (26%)
Similarity:100/241 - (41%) Gaps:32/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RILGGEDVAQGEYPWSASVRYNK---AHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLG 89
            :|:||.:......|:.||::.::   :|.|.|.:|....:||||||:..     :....:.|.||
  Rat   197 KIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQD-----ISWQLVTVVLG 256

  Fly    90 TINQYAGGSIVNVKSVIIHPSYGNF-----LHDIAILELDETLVFSDRIQDIALPPTTDEETEDV 149
            . :..........|..|......|:     |:|:.:|:|:.......::...:||        ..
  Rat   257 A-HDLLSSEPEQQKFTITQVFENNYNPEETLNDVLLLQLNRPASLGKQVAVASLP--------QQ 312

  Fly   150 DAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSLCEWEAGYGYESVVC-LSRAEGEGICR 213
            |..|..||.....|||.|.....:.:.......|:...||.       |..|| |......|||.
  Rat   313 DQSLSQGTQCLAMGWGRLGTRAPTPRVLHELNVTVVTFLCR-------EHNVCTLVPRRAAGICF 370

  Fly   214 GDAGAAVIDDDKVLRGLTSFNFGPCGS-KYPDVATRVSYYLTWIEA 258
            ||:|..:|.:. :|.|:.||....|.| ::||...|||.|:.||.:
  Rat   371 GDSGGPLICNG-ILHGVDSFVIRECASLQFPDFFARVSMYVNWIHS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 62/237 (26%)
Tryp_SPc 29..259 CDD:238113 64/240 (27%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 64/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.