DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and LOC312273

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:261 Identity:73/261 - (27%)
Similarity:115/261 - (44%) Gaps:43/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIFGLILSAEASP----QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSS 73
            :.|.|:.:..|.|    ..||:||....:...|:..|:... :|:|.|::|:...:|:||||.. 
  Rat     5 IFFTLLGTVAAFPTEDNDDRIVGGYTCQEHSVPYQVSLNAG-SHICGGSLITDQWVLSAAHCYH- 67

  Fly    74 VGITPVDASTLAVRLGTINQY---AGGSIVNVKSVIIHPSYGNFL--HDIAILELDETLVFSDRI 133
                    ..|.||||..|.|   .....::...:|:||.|..:.  :||.:::|......:.::
  Rat    68 --------PQLQVRLGEHNIYEIEGAEQFIDAAKMILHPDYDKWTVDNDIMLIKLKSPATLNSKV 124

  Fly   134 QDIALP---PTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYK-QQKANYNTLSRSLCEWEAG 194
            ..|.||   ||.             ||...|:|||.|..|..|.. .|..:...||.|:|  ...
  Rat   125 STIPLPQYCPTA-------------GTECLVSGWGVLKFGFESPSVLQCLDAPVLSDSVC--HKA 174

  Fly   195 YGYE---SVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTW 255
            |..:   ::.||...| |:..|:.|:|..|:.:.:| :|:.|:..|......|.|.|:|..||.|
  Rat   175 YPRQITNNMFCLGFLEGGKDSCQYDSGGPVVCNGEV-QGIVSWGDGCALEGKPGVYTKVCNYLNW 238

  Fly   256 I 256
            |
  Rat   239 I 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 67/240 (28%)
Tryp_SPc 29..259 CDD:238113 68/241 (28%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 68/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.