DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk8

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:287 Identity:73/287 - (25%)
Similarity:120/287 - (41%) Gaps:71/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRITLGLGLLIFGLILSAEAS---PQG-RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHI 64
            |...:...:|:| |::.|.|.   .|| :||.|::......||..::...:..||.|.::....:
  Rat     5 PPCAIQTWILLF-LLMGAWAGLTRAQGSKILEGQECKPHSQPWQTALFQGERLVCGGVLVGDRWV 68

  Fly    65 LTAAHCVSSVGITPVDASTLAVRLGTINQYAGGSI---------VNVKSVIIHPSYG-----NFL 115
            ||||||         .....:||||      ..|:         :.|...|.||.:.     :..
  Rat    69 LTAAHC---------KKDKYSVRLG------DHSLQKRDEPEQEIQVARSIQHPCFNSSNPEDHS 118

  Fly   116 HDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPN-----GTPVYVAGWGELSDGTASYK 175
            |||.::.|..:....|:::.|               ||.|     |....::|||.::....::.
  Rat   119 HDIMLIRLQNSANLGDKVKPI---------------ELANLCPKVGQKCIISGWGTVTSPQENFP 168

  Fly   176 QQKANYNTL--------SRSLCEWE-AGYGYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLT 231
                  |||        |::.||.. .|...|.:||...:.|...|:||:|..::.:. ||:|:|
  Rat   169 ------NTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCNG-VLQGIT 226

  Fly   232 SFNFGPCGS-KYPDVATRVSYYLTWIE 257
            |:...|||. :.|.|.|::..|..||:
  Rat   227 SWGSDPCGKPEKPGVYTKICRYTNWIK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 63/256 (25%)
Tryp_SPc 29..259 CDD:238113 65/258 (25%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 63/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341289
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.