DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Elane

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:270 Identity:76/270 - (28%)
Similarity:114/270 - (42%) Gaps:53/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLGLGLLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCV 71
            ||...||...|:..|.||   .|:||.......:|:..|::....|.|...:|:.|.:::|||||
  Rat    14 TLASMLLALLLVCPALAS---EIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHCV 75

  Fly    72 SSVGITPVD----ASTLAVRLGTINQYAGGSIVNVKSVI---IHPSYGNFLHDIAILELDETLVF 129
            :......|.    |..|..|..|      ..|.:|:.:.   ..||  ..|:||.|::|:.:...
  Rat    76 NGRNFQSVQVVLGAHDLRRREPT------RQIFSVQRIFENGFDPS--RLLNDIVIIQLNGSATI 132

  Fly   130 SDRIQDIALPPTTDEETEDVDAELP-------NGTPVYVAGWGELSDGT---ASYKQQKANYNTL 184
            :..:|               .||||       |.||....|||.|  ||   .....|:.|. |:
  Rat   133 NANVQ---------------VAELPAQGQGVGNRTPCVAMGWGRL--GTNRPLPSVLQELNV-TV 179

  Fly   185 SRSLCEWEAGYGYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSK-YPDVATR 248
            ..:||....     :|..|......|||.||:|..::.:: :::|:.||..|.|||. |||....
  Rat   180 VTNLCRRRV-----NVCTLVPRRQAGICFGDSGGPLVCNN-LVQGIDSFIRGGCGSGFYPDAFAP 238

  Fly   249 VSYYLTWIEA 258
            |:.:..||.:
  Rat   239 VAEFADWINS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/245 (27%)
Tryp_SPc 29..259 CDD:238113 68/248 (27%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 66/245 (27%)
Tryp_SPc 33..249 CDD:238113 68/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.