DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk1c3

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:271 Identity:76/271 - (28%)
Similarity:116/271 - (42%) Gaps:52/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIFGLILS---AEASP--QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVS 72
            ||..|.||   .:|:|  |.|::||....:...||..:| .|: .:|.|.:|..:.::|||||.|
  Rat     4 LILFLALSLGQIDAAPPGQSRVVGGFKCEKNSQPWQVAV-INE-DLCGGVLIDPSWVITAAHCYS 66

  Fly    73 SVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFL------------HDIAILELDE 125
                     ....|.||..|.........|.....||.|..||            :|:.:|.|.|
  Rat    67 ---------DNYHVLLGQNNLSEDVQHRLVSQSFRHPDYKPFLMRNHTRKPKDYSNDLMLLHLSE 122

  Fly   126 TLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ--QKANYNTLSRSL 188
            ....:|.::.|.| ||.:.:.         |:...|:|||..:.....:..  |..|.:.||...
  Rat   123 PADITDGVKVIDL-PTKEPKV---------GSTCLVSGWGSTNPSEWEFPDDLQCVNIHLLSNEK 177

  Fly   189 CEWEAGYGYES-----VVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGS-KYPDVA 246
            |.    ..|:.     ::|....| |:..||||:|..:|.|. ||:|:||:...|||. ..|.:.
  Rat   178 CI----KAYKEKVTDLMLCAGELEGGKDTCRGDSGGPLICDG-VLQGITSWGSVPCGEPNKPGIY 237

  Fly   247 TRVSYYLTWIE 257
            |::..:.:||:
  Rat   238 TKLIKFTSWIK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/248 (27%)
Tryp_SPc 29..259 CDD:238113 67/250 (27%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 66/248 (27%)
Tryp_SPc 25..250 CDD:238113 67/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341276
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.