DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk1c8

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001013085.2 Gene:Klk1c8 / 292866 RGDID:1305359 Length:261 Species:Rattus norvegicus


Alignment Length:276 Identity:78/276 - (28%)
Similarity:122/276 - (44%) Gaps:54/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFGLILSA---EASP--QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCV 71
            |||..||||.   :|:|  |.||:||.:..:...||..:|.:.....|.|.:|..:.::|||||.
  Rat     3 LLILFLILSLGWNDAAPPGQSRIIGGFNCEKNSQPWQVAVYHFNEPQCGGVLIHPSWVITAAHCY 67

  Fly    72 SSVGITPVDASTLAVRLGTIN-----QYAGGSIVNVKSVIIHPSY------------GN-FLHDI 118
            |         ....|.||..|     .:|...:|:  ....||.:            || :.:|:
  Rat    68 S---------VNYQVWLGRNNLLEDEPFAQHRLVS--QSFPHPGFNLDIIKNHTRKPGNDYSNDL 121

  Fly   119 AILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ--QKANY 181
            .:|.|......:|.::.|.||      ||:...    |:....:|||.::.....:..  |..|.
  Rat   122 MLLHLKTPADITDGVKVIDLP------TEEPKV----GSTCLTSGWGSITPLKWEFPDDLQCVNI 176

  Fly   182 NTLSRSLCEWEAGYGYE---SVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGS-K 241
            :.||...|  ...|..|   .::|....: |:.||:||:|..:|.|. ||:|:||:...|||. .
  Rat   177 HLLSNEKC--IKAYNDEVTDVMLCAGEMDGGKDICKGDSGGPLICDG-VLQGITSWGSMPCGEPN 238

  Fly   242 YPDVATRVSYYLTWIE 257
            .|.|.|::..:.:||:
  Rat   239 KPSVYTKLIKFTSWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/252 (26%)
Tryp_SPc 29..259 CDD:238113 67/254 (26%)
Klk1c8NP_001013085.2 Tryp_SPc 24..253 CDD:214473 66/252 (26%)
Tryp_SPc 25..256 CDD:238113 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.