DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk1c12

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_017444409.1 Gene:Klk1c12 / 292855 RGDID:1303192 Length:262 Species:Rattus norvegicus


Alignment Length:279 Identity:76/279 - (27%)
Similarity:117/279 - (41%) Gaps:59/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFGLILSA---EASP--QGRILGGEDVAQGEYPWSASV--RYNKAHVCSGAIISTNHILTAAH 69
            |.|..|.||.   :|:|  |.|::||....:...||..:|  ||    :|.|.:|..:.::||||
  Rat     3 LQILFLFLSVGRIDAAPPGQSRVVGGYKCEKNSQPWQVAVINRY----LCGGVLIDPSWVITAAH 63

  Fly    70 CVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSV---IIHPSYGNFL-------------HDI 118
            |.|..      .|...|.||..|.:........:.|   ..||.|..|.             :|:
  Rat    64 CYSHA------LSNYHVLLGRNNLFKDEPFAQYRFVNQSFPHPDYNPFFMKNHTLFPGDDHSNDL 122

  Fly   119 AILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWG-------ELSDGTASYKQ 176
            .:|.|.|....:|.::.|.||      ||:...    |:....:||.       |..|..     
  Rat   123 MLLHLSEPADITDGVKVIDLP------TEEPKV----GSTCLASGWSSTKPLEWEFPDDL----- 172

  Fly   177 QKANYNTLSRSLC-EWEAGYGYESVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCG 239
            |..|.|.||...| :.......:.::|....| |:..|.||:|..::.|. ||:|:||::..|||
  Rat   173 QCVNINILSNEKCIKAHTQMVTDVMLCAGELEGGKDTCNGDSGGPLLCDG-VLQGITSWSSVPCG 236

  Fly   240 -SKYPDVATRVSYYLTWIE 257
             :..|.:.|::..:.:||:
  Rat   237 ETNRPAIYTKLIKFTSWIK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/255 (26%)
Tryp_SPc 29..259 CDD:238113 67/257 (26%)
Klk1c12XP_017444409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.