DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk7

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:266 Identity:69/266 - (25%)
Similarity:121/266 - (45%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLLIFGLILSAEASPQG-RILGGEDVAQGEYPWS-ASVRYNKAHVCSGAIISTNHILTAAHCVS 72
            |.||...|.|:.|.:.|| ||:.|....:|.:||. |.::.::.| |.|.::..:.:||||||  
  Rat     6 LSLLTVLLSLALETAGQGERIIDGYKCKEGSHPWQVALLKGDQLH-CGGVLVGESWVLTAAHC-- 67

  Fly    73 SVGITPVDASTLAVRLGTINQYAGGSIVNVKSV--------IIHPSYGNFLH--DIAILELDETL 127
                          ::|....:.|...:..:|.        ..||.|....|  ||.::::|:.:
  Rat    68 --------------KMGQYTVHLGSDKIEDQSAQRIKASRSFRHPGYSTRTHVNDIMLVKMDKPV 118

  Fly   128 VFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQK--ANYNTLSRSLCE 190
            ..||::|.:.||...:          |.||...|:|||..:....::....  ::...:|...|:
  Rat   119 KMSDKVQKVKLPDHCE----------PPGTLCTVSGWGTTTSPDVTFPSDLMCSDVKLISSQECK 173

  Fly   191 --WEAGYGYESVVCLSRAEGE-GICRGDAGAAVIDDDKVLRGLTSFNFGPCGS-KYPDVATRVSY 251
              ::...| ::::|....:.: ..|.||:|..::.:| .|:||.|:...|||. ..|.|.|:|..
  Rat   174 KVYKDLLG-KTMLCAGIPDSKTNTCNGDSGGPLVCND-TLQGLVSWGTYPCGQPNDPGVYTQVCK 236

  Fly   252 YLTWIE 257
            |..|:|
  Rat   237 YQRWLE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 59/244 (24%)
Tryp_SPc 29..259 CDD:238113 60/246 (24%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 59/243 (24%)
Tryp_SPc 26..244 CDD:238113 60/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.