DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk11

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:263 Identity:57/263 - (21%)
Similarity:104/263 - (39%) Gaps:54/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHC--------VSSV 74
            :::.....:.||:.|.:......||..::......:|...:|:...:||||||        :...
  Rat    40 LVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHCRKPHYVILLGEH 104

  Fly    75 GITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFL------HDIAILELDETLVFSDRI 133
            .:...|..... |:.|             ....||.:.|.|      :||.::::......:..:
  Rat   105 NLEKTDGCEQR-RMAT-------------ESFPHPGFNNSLPNKDHRNDIMLVKMSSPAFITRAV 155

  Fly   134 QDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQK-------ANYNTLSRSLCEW 191
            :.:.|....          :..||...::||     ||.|..|.:       ||.:.:....||.
  Rat   156 RPLTLSSLC----------VTAGTSCLISGW-----GTTSSPQLRLPHSLRCANVSIIGHKECER 205

  Fly   192 E-AGYGYESVVCLS-RAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCG-SKYPDVATRVSYYL 253
            . .|...::::|.| |.||:..|:||:|..::.:.. |:|:.|:...||. ::.|.|.|:|..|.
  Rat   206 AYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGS-LQGIISWGQDPCAVTRKPGVYTKVCKYF 269

  Fly   254 TWI 256
            .||
  Rat   270 DWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 55/251 (22%)
Tryp_SPc 29..259 CDD:238113 56/252 (22%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 55/251 (22%)
Tryp_SPc 51..275 CDD:238113 56/252 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.