DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk13

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:258 Identity:80/258 - (31%)
Similarity:113/258 - (43%) Gaps:41/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDAS 82
            ||:......|.:.||........||.|::......:|.|.::....:||||||... |.|     
  Rat    26 ILNGTNGTSGFLPGGYTCLPHSQPWQAALLVRGRLLCGGVLVHPKWVLTAAHCRKD-GYT----- 84

  Fly    83 TLAVRLGTINQYAGGSIVN-------VKSVIIHPSYG------NFLHDIAILELDETLVFSDRIQ 134
               |.||   ::|.|.:.|       |:| |.||.|.      |..|||.:|||...:..|:.::
  Rat    85 ---VHLG---KHALGRVENGEQAMEVVRS-IPHPEYQVSPTHLNHDHDIMLLELKSPVQLSNHVR 142

  Fly   135 DIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ--QKANYNTLSRSLC-EWEAGYG 196
            .:.|         ..|..||.||...|:|||..:....:|.:  |.||....|...| :...|..
  Rat   143 TLQL---------SADDCLPTGTCCRVSGWGTTTSPQVNYPKTLQCANIELRSDEECRQVYPGKI 198

  Fly   197 YESVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGS-KYPDVATRVSYYLTWIE 257
            ..:::|....| |:..|.||:|..:|.:.| |.|:.|:...|||. ..|.|.||||.||.||:
  Rat   199 TANMLCAGTKEGGKDSCEGDSGGPLICNGK-LYGIISWGDFPCGQPNRPGVYTRVSKYLRWIQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 75/245 (31%)
Tryp_SPc 29..259 CDD:238113 77/247 (31%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 77/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.