DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Prss34

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:269 Identity:77/269 - (28%)
Similarity:122/269 - (45%) Gaps:67/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ILGGEDVAQGEYPWSASVR-YNK-----AHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVR 87
            |:||..|:...:||..|:| ||.     .|:|.|::|....:|||||||.   :..::||...|:
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVE---LKEMEASCFRVQ 94

  Fly    88 LGTINQYAGGSIVNVKSVIIHPSYGNFLH-----DIAILELDETLVFSDRIQDIALPPTTDEETE 147
            :|.:..|....::.|..:|.||.:...|.     |||:|:||.|:|.|:|:..::||..:.    
  Rat    95 VGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQ---- 155

  Fly   148 DVDAELPNGTPVYVAGWGELSD------------------GTASYKQQKANYNTLSRS------- 187
                .:.:....:|||||.:..                  |.:..:|:...|::|.|:       
  Rat   156 ----RISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDD 216

  Fly   188 -LCEWEAGYGYESVVCLSRAEGEGICRGDAGAAVI---DDDKVLRGLTSFNFGPCG-SKYPDVAT 247
             ||   ||           .||...|:.|:|..::   :...|..|:.|:..| || ..:|.|.|
  Rat   217 MLC---AG-----------MEGRDSCQADSGGPLVCRWNCSWVQVGVVSWGIG-CGLPDFPGVYT 266

  Fly   248 RVSYYLTWI 256
            ||..||:||
  Rat   267 RVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 75/267 (28%)
Tryp_SPc 29..259 CDD:238113 77/269 (29%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 77/269 (29%)
Tryp_SPc 33..275 CDD:214473 75/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24256
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.