DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and KLK9

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:263 Identity:74/263 - (28%)
Similarity:110/263 - (41%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLLIFGL-ILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSS 73
            ||||...| :|:.......|.:|.|:......||.|.:.:.....|...:||...:||||||...
Human     3 LGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHCRKP 67

  Fly    74 VGITPVDASTLAVRLGT--INQYAG-GSIVNVKSVIIHPSYGNFL------HDIAILELDETLVF 129
            .         |.||||.  :.::.| ..:..|.....||.:...|      .||.::.|......
Human    68 Y---------LWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARL 123

  Fly   130 SDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASY--KQQKANYNTLSRSLCEWE 192
            |..:|.:.|..|.          :..|....::|||.:|...|.:  ..|.||.:.|...||.|.
Human   124 SPAVQPLNLSQTC----------VSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWA 178

  Fly   193 -AGYGYESVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCG-SKYPDVATRVSYYLT 254
             .|:..:|::|....| |.|.|:||:|..::.:. .|.|:.|....||. .:.|.|.|.|.:||.
Human   179 YPGHISDSMLCAGLWEGGRGSCQGDSGGPLVCNG-TLAGVVSGGAEPCSRPRRPAVYTSVCHYLD 242

  Fly   255 WIE 257
            ||:
Human   243 WIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/241 (27%)
Tryp_SPc 29..259 CDD:238113 67/243 (28%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.