DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG33225

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:261 Identity:65/261 - (24%)
Similarity:108/261 - (41%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSS----VGITPVDASTLAVRL 88
            |::||.|..:...||...|.......|||::|:...:||:|.|:.|    |.:...|.:..:...
  Fly    56 RVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCLLSLPKQVILGEYDRNCTSADC 120

  Fly    89 GTINQYAGGSIVNVKSVIIHPSYGNFL---HDIAILELDETLVFSDRIQDIALPPTTDEETEDVD 150
            .:|.|     ::::...|||..:|...   :|||:|.|.:.:..||.::.|.|         .||
  Fly   121 TSIRQ-----VIDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICL---------SVD 171

  Fly   151 AELPNGTPVYVA-GWGELSDGTASYKQQKANYNTLSRSLCEWEAGYGYE-SVVCLSRAEGEGICR 213
            .::......:.| |||.......|...|....:.::|..|:.......: |.:|:. ...:..|.
  Fly   172 RQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKYCKGRLRQNIDASQLCVG-GPRKDTCS 235

  Fly   214 GDAGAAV-----IDDD--------KVLRGLTSFNFGPCGSKYPDVATRVSYYLTWI-----EANT 260
            ||||..:     ||.|        ..|.|:.|:....|..  ..|.|.|.:|:.||     ::||
  Fly   236 GDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSG--IGVYTNVEHYMDWIVRTINKSNT 298

  Fly   261 Q 261
            :
  Fly   299 E 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 61/249 (24%)
Tryp_SPc 29..259 CDD:238113 62/256 (24%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 61/249 (24%)
Tryp_SPc 57..292 CDD:238113 62/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.