DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk8

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001311327.1 Gene:Klk8 / 259277 MGIID:1343327 Length:260 Species:Mus musculus


Alignment Length:266 Identity:70/266 - (26%)
Similarity:113/266 - (42%) Gaps:48/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGI 76
            ||..|.......:...:||.|.:......||.|::...:..:|.|.::....:||||||      
Mouse    16 LLFMGAWAGLTRAQGSKILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHC------ 74

  Fly    77 TPVDASTLAVRLGTINQYAGG---SIVNVKSVIIHPSYGN-----FLHDIAILELDETLVFSDRI 133
               .....:||||..:..:..   ..:.|...|.||.|.|     ..|||.::.|..:....|::
Mouse    75 ---KKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKV 136

  Fly   134 QDIALPPTTDEETEDVDAEL-PN-GTPVYVAGWGELSDGTASYKQQKANYNTL--------SRSL 188
            :.:.|            |.| |. |....::|||.::....::.      |||        |::.
Mouse   137 KPVQL------------ANLCPKVGQKCIISGWGTVTSPQENFP------NTLNCAEVKIYSQNK 183

  Fly   189 CEWE-AGYGYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGS-KYPDVATRVSY 251
            ||.. .|...|.:||...:.|...|:||:|..::.|. :|:|:||:...|||. :.|.|.|::..
Mouse   184 CERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDG-MLQGITSWGSDPCGKPEKPGVYTKICR 247

  Fly   252 YLTWIE 257
            |.|||:
Mouse   248 YTTWIK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 65/247 (26%)
Tryp_SPc 29..259 CDD:238113 67/249 (27%)
Klk8NP_001311327.1 Tryp_SPc 32..252 CDD:214473 65/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.